Gene/Proteome Database (LMPD)
Proteins
geranylgeranyl transferase type-2 subunit beta | |
---|---|
Refseq ID | NP_001248489 |
Protein GI | 387763241 |
UniProt ID | F6TFB0 |
mRNA ID | NM_001261560 |
Length | 331 |
Protein sequence is identical to GI:109008511 (mRNA isoform) |
Refseq ID | XP_001101556 |
Protein GI | 109008511 |
UniProt ID | F6TFB0 |
mRNA ID | XM_001101556 |
Length | 331 |
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS |
Gene Information
Entrez Gene ID
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0004663 | IEA:InterPro | F | Rab geranylgeranyltransferase activity |
GO:0018344 | IEA:InterPro | P | protein geranylgeranylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Rab geranylgeranyltransferase, beta subunit
Protein Entry
F6TFB0_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014748 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109008511 | RefSeq | XP_001101556 | 331 | Rab geranylgeranyltransferase, beta subunit |
Identical Sequences to LMP014748 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:387763241 | RefSeq | XP_008954275.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan paniscus] |
GI:387763241 | RefSeq | XP_009247146.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pongo abelii] |
GI:387763241 | RefSeq | XP_009421905.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan troglodytes] |
GI:387763241 | RefSeq | XP_010366901.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Rhinopithecus roxellana] |
Related Sequences to LMP014748 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:387763241 | EMBL | CAG33222.1 | 331 | RABGGTB [Homo sapiens] |
GI:387763241 | RefSeq | XP_007976447.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Chlorocebus sabaeus] |