Gene/Proteome Database (LMPD)

LMPD ID
LMP014748
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Alternate Names
geranylgeranyl transferase type-2 subunit beta;
Chromosome
1
Map Location
chromosome:1

Proteins

geranylgeranyl transferase type-2 subunit beta
Refseq ID NP_001248489
Protein GI 387763241
UniProt ID F6TFB0
mRNA ID NM_001261560
Length 331
Protein sequence is identical to GI:109008511 (mRNA isoform)
Refseq ID XP_001101556
Protein GI 109008511
UniProt ID F6TFB0
mRNA ID XM_001101556
Length 331
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Gene Information

Entrez Gene ID
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004663 IEA:InterPro F Rab geranylgeranyltransferase activity
GO:0018344 IEA:InterPro P protein geranylgeranylation

Domain Information

InterPro Annotations

Accession Description
IPR026873 Geranylgeranyl transferase type-2 subunit beta
IPR001330 Prenyltransferase/squalene oxidase
IPR008930 Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid

UniProt Annotations

Entry Information

Gene Name
Rab geranylgeranyltransferase, beta subunit
Protein Entry
F6TFB0_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014748 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109008511 RefSeq XP_001101556 331 Rab geranylgeranyltransferase, beta subunit

Identical Sequences to LMP014748 proteins

Reference Database Accession Length Protein Name
GI:387763241 RefSeq XP_008954275.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan paniscus]
GI:387763241 RefSeq XP_009247146.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pongo abelii]
GI:387763241 RefSeq XP_009421905.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Pan troglodytes]
GI:387763241 RefSeq XP_010366901.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Rhinopithecus roxellana]

Related Sequences to LMP014748 proteins

Reference Database Accession Length Protein Name
GI:387763241 EMBL CAG33222.1 331 RABGGTB [Homo sapiens]
GI:387763241 RefSeq XP_007976447.1 331 PREDICTED: geranylgeranyl transferase type-2 subunit beta isoform X1 [Chlorocebus sabaeus]