Gene/Proteome Database (LMPD)

LMPD ID
LMP014796
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
methylsterol monooxygenase 1
Gene Symbol
Synonyms
MSMO1;
Alternate Names
methylsterol monooxygenase 1; C-4 methylsterol oxidase;
Chromosome
5
Map Location
chromosome:5

Proteins

methylsterol monooxygenase 1
Refseq ID NP_001247732
Protein GI 386782219
UniProt ID F7HR97
mRNA ID NM_001260803
Length 293
Protein sequence is identical to GI:109076095 (mRNA isoform)
Refseq ID XP_001101334
Protein GI 109076095
UniProt ID F7HR97
mRNA ID XM_001101517
Length 293
MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFSFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFMHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYHAYYEKRKKFEKKTE
Refseq ID XP_001101517
Protein GI 109076099
UniProt ID F7HR97
mRNA ID XM_001101517
Length 293
Protein sequence is identical to GI:109076095 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
methylsterol monooxygenase 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005506 IEA:InterPro F iron ion binding
GO:0016491 IEA:InterPro F oxidoreductase activity
GO:0006633 IEA:InterPro P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mcc01100 Metabolic pathways
ko00100 Steroid biosynthesis
mcc00100 Steroid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
methylsterol monooxygenase 1
Protein Entry
F7HR97_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014796 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109076095 RefSeq XP_001101334 293 methylsterol monooxygenase 1

Identical Sequences to LMP014796 proteins

Reference Database Accession Length Protein Name
GI:386782219 GenBank AFH33524.1 293 C-4 methylsterol oxidase isoform 1 [Macaca mulatta]
GI:386782219 GenBank AFI35882.1 293 C-4 methylsterol oxidase isoform 1 [Macaca mulatta]
GI:386782219 RefSeq XP_005556297.1 293 PREDICTED: methylsterol monooxygenase 1 isoform X1 [Macaca fascicularis]
GI:386782219 RefSeq XP_005556298.1 293 PREDICTED: methylsterol monooxygenase 1 isoform X2 [Macaca fascicularis]

Related Sequences to LMP014796 proteins

Reference Database Accession Length Protein Name
GI:386782219 GenBank EHH26292.1 293 hypothetical protein EGK_16219 [Macaca mulatta]
GI:386782219 GenBank EHH54056.1 293 hypothetical protein EGM_14799 [Macaca fascicularis]