Gene/Proteome Database (LMPD)
Proteins
methylsterol monooxygenase 1 | |
---|---|
Refseq ID | NP_001247732 |
Protein GI | 386782219 |
UniProt ID | F7HR97 |
mRNA ID | NM_001260803 |
Length | 293 |
Protein sequence is identical to GI:109076095 (mRNA isoform) |
Refseq ID | XP_001101334 |
Protein GI | 109076095 |
UniProt ID | F7HR97 |
mRNA ID | XM_001101517 |
Length | 293 |
MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFSFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFMHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYHAYYEKRKKFEKKTE |
Refseq ID | XP_001101517 |
Protein GI | 109076099 |
UniProt ID | F7HR97 |
mRNA ID | XM_001101517 |
Length | 293 |
Protein sequence is identical to GI:109076095 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
methylsterol monooxygenase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
methylsterol monooxygenase 1
Protein Entry
F7HR97_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014796 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109076095 | RefSeq | XP_001101334 | 293 | methylsterol monooxygenase 1 |
Identical Sequences to LMP014796 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386782219 | GenBank | AFH33524.1 | 293 | C-4 methylsterol oxidase isoform 1 [Macaca mulatta] |
GI:386782219 | GenBank | AFI35882.1 | 293 | C-4 methylsterol oxidase isoform 1 [Macaca mulatta] |
GI:386782219 | RefSeq | XP_005556297.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Macaca fascicularis] |
GI:386782219 | RefSeq | XP_005556298.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X2 [Macaca fascicularis] |
Related Sequences to LMP014796 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386782219 | GenBank | EHH26292.1 | 293 | hypothetical protein EGK_16219 [Macaca mulatta] |
GI:386782219 | GenBank | EHH54056.1 | 293 | hypothetical protein EGM_14799 [Macaca fascicularis] |