Gene/Proteome Database (LMPD)
Proteins
lathosterol oxidase | |
---|---|
Refseq ID | NP_001244446 |
Protein GI | 383873177 |
UniProt ID | F7CI54 |
mRNA ID | NM_001257517 |
Length | 299 |
Protein sequence is identical to GI:109109033 (mRNA isoform) |
Refseq ID | XP_001107388 |
Protein GI | 109109033 |
UniProt ID | F7CI54 |
mRNA ID | XM_001107388 |
Length | 299 |
MDLVLGVADYYFFTPYVYPATWPEDDIFRQTISLLIVTNVGAYILYFFCATLSYYFVFDHALMKHPQFLKNQVRREIKFTVQALPLISIFTVPLFLLELRGYSKLHDDLGEFPYGLFELIISIISFLFFTDMFIYWIHRGLHHRLVYKRLHKPHHTWKIPTPFASHAFHPVDGFLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKYSSHAGNGCKNEKLFNGEFTKTE |
Gene Information
Entrez Gene ID
Gene Name
sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like
Protein Entry
F7CI54_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014797 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109109033 | RefSeq | XP_001107388 | 299 | sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like |
Identical Sequences to LMP014797 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383873177 | GenBank | EHH56844.1 | 299 | hypothetical protein EGM_06328 [Macaca fascicularis] |
GI:383873177 | GenBank | AFE79600.1 | 299 | lathosterol oxidase [Macaca mulatta] |
GI:383873177 | GenBank | AFE79601.1 | 299 | lathosterol oxidase [Macaca mulatta] |
GI:383873177 | GenBank | AFE79602.1 | 299 | lathosterol oxidase [Macaca mulatta] |
Related Sequences to LMP014797 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383873177 | GenBank | EHH23527.1 | 299 | hypothetical protein EGK_07004 [Macaca mulatta] |