Gene/Proteome Database (LMPD)
LMPD ID
LMP014806
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Gene Symbol
Alternate Names
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial;
Chromosome
1
Map Location
chromosome:1
EC Number
1.3.5.1
Proteins
| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial | |
|---|---|
| Refseq ID | NP_001248733 |
| Protein GI | 387763182 |
| UniProt ID | F7GTK4 |
| mRNA ID | NM_001261804 |
| Length | 280 |
| Protein sequence is identical to GI:108998301 (mRNA isoform) | |
| Refseq ID | XP_001088349 |
| Protein GI | 108998301 |
| UniProt ID | F7GTK4 |
| mRNA ID | XM_001088349 |
| Length | 280 |
| MAAVVALSLRGRLPATALGGACLQASRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQTYEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV | |
Gene Information
Entrez Gene ID
Gene Name
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0051537 | IEA:InterPro | F | 2 iron, 2 sulfur cluster binding |
| GO:0009055 | IEA:InterPro | F | electron carrier activity |
| GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
| GO:0006099 | IEA:InterPro | P | tricarboxylic acid cycle |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko05010 | Alzheimer's disease |
| mcc05010 | Alzheimer's disease |
| ko01200 | Carbon metabolism |
| mcc01200 | Carbon metabolism |
| ko00020 | Citrate cycle (TCA cycle) |
| mcc00020 | Citrate cycle (TCA cycle) |
| M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
| mcc_M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
| M00011 | Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate |
| mcc_M00011 | Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate |
| ko05016 | Huntington's disease |
| mcc05016 | Huntington's disease |
| mcc01100 | Metabolic pathways |
| ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
| mcc04932 | Non-alcoholic fatty liver disease (NAFLD) |
| ko00190 | Oxidative phosphorylation |
| mcc00190 | Oxidative phosphorylation |
| mcc05012 | Parkinson's disease |
| M00148 | Succinate dehydrogenase (ubiquinone) |
| mcc_M00148 | Succinate dehydrogenase (ubiquinone) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site |
| IPR001041 | 2Fe-2S ferredoxin-type domain |
| IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
| IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| IPR009051 | Alpha-helical ferredoxin |
| IPR012675 | Beta-grasp domain |
| IPR025192 | Succinate dehydogenase/fumarate reductase N-terminal |
| IPR004489 | Succinate dehydrogenase/fumarate reductase iron-sulphur protein |
UniProt Annotations
Entry Information
Gene Name
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Protein Entry
F7GTK4_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Succinate + a quinone = fumarate + a quinol. |
| Cofactor | Note=Binds 1 2Fe-2S cluster. ; |
| Cofactor | Note=Binds 1 3Fe-4S cluster. ; |
| Cofactor | Note=Binds 1 4Fe-4S cluster. ; |
| Function | Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). |
| Pathway | Carbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1. |
| Similarity | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. |
| Similarity | Contains 1 2Fe-2S ferredoxin-type domain. |
| Similarity | Contains 1 4Fe-4S ferredoxin-type domain. |
| Subcellular Location | Mitochondrion inner membrane ; Peripheral membrane protein ; Matrix side |
Identical and Related Proteins
Unique RefSeq proteins for LMP014806 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 108998301 | RefSeq | XP_001088349 | 280 | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
Identical Sequences to LMP014806 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:387763182 | GenBank | AFE66155.1 | 280 | succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor [Macaca mulatta] |
| GI:387763182 | GenBank | AFH27891.1 | 280 | succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor [Macaca mulatta] |
| GI:387763182 | GenBank | AFI35531.1 | 280 | succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor [Macaca mulatta] |
| GI:387763182 | RefSeq | NP_001271575.1 | 280 | uncharacterized protein LOC101865119 [Macaca fascicularis] |
Related Sequences to LMP014806 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:387763182 | GenBank | EHH49577.1 | 280 | hypothetical protein EGM_00264 [Macaca fascicularis] |