Gene/Proteome Database (LMPD)
Proteins
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 | |
|---|---|
| Refseq ID | NP_001253270 |
| Protein GI | 388453489 |
| UniProt ID | F6XP05 |
| mRNA ID | NM_001266341 |
| Length | 350 |
| Protein sequence is identical to GI:109129168 (mRNA isoform) | |
| Refseq ID | XP_001107274 |
| Protein GI | 109129168 |
| UniProt ID | F6XP05 |
| mRNA ID | XM_001107274 |
| Length | 350 |
| MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYAGLQRLSKEGLSGKSCTCRRCMGDTGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0003836 | IEA:Ensembl | F | beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
| mcc00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
| ko00604 | Glycosphingolipid biosynthesis - ganglio series |
| mcc00604 | Glycosphingolipid biosynthesis - ganglio series |
| ko00603 | Glycosphingolipid biosynthesis - globo series |
| mcc00603 | Glycosphingolipid biosynthesis - globo series |
| mcc01100 | Metabolic pathways |
| ko00512 | Mucin type O-Glycan biosynthesis |
| mcc00512 | Mucin type O-Glycan biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Protein Entry
F6XP05_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014910 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109129168 | RefSeq | XP_001107274 | 350 | ST3 beta-galactoside alpha-2,3-sialyltransferase 2 |
Identical Sequences to LMP014910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388453489 | GenBank | AFI34321.1 | 350 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca mulatta] |
| GI:388453489 | RefSeq | XP_005592577.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Macaca fascicularis] |
| GI:388453489 | RefSeq | XP_005592578.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X2 [Macaca fascicularis] |
| GI:388453489 | RefSeq | XP_007991847.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Chlorocebus sabaeus] |
Related Sequences to LMP014910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388453489 | GenBank | EHH31838.1 | 350 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca mulatta] |
| GI:388453489 | GenBank | EHH60555.1 | 350 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca fascicularis] |
| GI:388453489 | GenBank | AFE75884.1 | 350 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca mulatta] |