Gene/Proteome Database (LMPD)

LMPD ID
LMP014910
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Gene Symbol
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2;
Chromosome
20
Map Location
chromosome:20

Proteins

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
Refseq ID NP_001253270
Protein GI 388453489
UniProt ID F6XP05
mRNA ID NM_001266341
Length 350
Protein sequence is identical to GI:109129168 (mRNA isoform)
Refseq ID XP_001107274
Protein GI 109129168
UniProt ID F6XP05
mRNA ID XM_001107274
Length 350
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYAGLQRLSKEGLSGKSCTCRRCMGDTGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Gene Information

Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0003836 IEA:Ensembl F beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00533 Glycosaminoglycan biosynthesis - keratan sulfate
mcc00533 Glycosaminoglycan biosynthesis - keratan sulfate
ko00604 Glycosphingolipid biosynthesis - ganglio series
mcc00604 Glycosphingolipid biosynthesis - ganglio series
ko00603 Glycosphingolipid biosynthesis - globo series
mcc00603 Glycosphingolipid biosynthesis - globo series
mcc01100 Metabolic pathways
ko00512 Mucin type O-Glycan biosynthesis
mcc00512 Mucin type O-Glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Protein Entry
F6XP05_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014910 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109129168 RefSeq XP_001107274 350 ST3 beta-galactoside alpha-2,3-sialyltransferase 2

Identical Sequences to LMP014910 proteins

Reference Database Accession Length Protein Name
GI:388453489 GenBank AFI34321.1 350 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca mulatta]
GI:388453489 RefSeq XP_005592577.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Macaca fascicularis]
GI:388453489 RefSeq XP_005592578.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X2 [Macaca fascicularis]
GI:388453489 RefSeq XP_007991847.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Chlorocebus sabaeus]

Related Sequences to LMP014910 proteins

Reference Database Accession Length Protein Name
GI:388453489 GenBank EHH31838.1 350 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca mulatta]
GI:388453489 GenBank EHH60555.1 350 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca fascicularis]
GI:388453489 GenBank AFE75884.1 350 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Macaca mulatta]