Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001091910 |
Protein GI | 297278488 |
mRNA ID | XM_001091910 |
Length | 344 |
MNLSSCVADSVVLSFDSAGQALGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014911 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297278488 | RefSeq | XP_001091910 | 344 |
Identical Sequences to LMP014911 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014911 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:297278488 | RefSeq | XP_004371890.1 | 397 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform 1 [Trichechus manatus latirostris] |
GI:297278488 | RefSeq | XP_004400697.1 | 395 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform 1 [Odobenus rosmarus divergens] |
GI:297278488 | RefSeq | XP_005317977.1 | 395 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X4 [Ictidomys tridecemlineatus] |
GI:297278488 | RefSeq | XP_007951243.1 | 397 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1 [Orycteropus afer afer] |