Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001089053 |
| Protein GI | 297284852 |
| mRNA ID | XM_001089053 |
| Length | 392 |
| MRQAPRERQQPAGVSGADGLRAAAPQVAEPGAPLWSPLLGLGGSLSPAGFAAGLHCPGEPAMRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014914 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297284852 | RefSeq | XP_001089053 | 392 |
Identical Sequences to LMP014914 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014914 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:297284852 | RefSeq | XP_005548381.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Macaca fascicularis] |
| GI:297284852 | RefSeq | XP_007984270.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Chlorocebus sabaeus] |
| GI:297284852 | RefSeq | XP_007984271.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Chlorocebus sabaeus] |
| GI:297284852 | RefSeq | XP_010352024.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rhinopithecus roxellana] |