Gene/Proteome Database (LMPD)
LMPD ID
LMP014918
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Gene Symbol
Alternate Names
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3;
Chromosome
1
Map Location
chromosome:1
Proteins
| alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 | |
|---|---|
| Refseq ID | NP_001248558 |
| Protein GI | 387763490 |
| UniProt ID | H9FSH2 |
| mRNA ID | NM_001261629 |
| Length | 305 |
| Protein sequence is identical to GI:109008725 (mRNA isoform) | |
| Refseq ID | XP_001098351 |
| Protein GI | 109008725 |
| UniProt ID | H9FSH2 |
| mRNA ID | XM_001098351 |
| Length | 305 |
| MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGHMTMIRVVSHTSVPLLLKNPDYFFKEANATIYVIWGPFRNMRKDGNGIVYNMLRKTVDIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGSYLSTGWFTFILAMDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWTLS | |
Gene Information
Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0006677 | IEA:Ensembl | P | glycosylceramide metabolic process |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Protein Entry
H9FSH2_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014918 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109008725 | RefSeq | XP_001098351 | 305 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 |
Identical Sequences to LMP014918 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:387763490 | GenBank | AFE77581.1 | 305 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 1 [Macaca mulatta] |
Related Sequences to LMP014918 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:387763490 | RefSeq | XP_003921447.1 | 305 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform X1 [Saimiri boliviensis boliviensis] |
| GI:387763490 | RefSeq | XP_005543040.1 | 305 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform X1 [Macaca fascicularis] |
| GI:387763490 | RefSeq | XP_007976439.1 | 305 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform X1 [Chlorocebus sabaeus] |