Gene/Proteome Database (LMPD)
LMPD ID
LMP014921
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Alternate Names
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1; Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase;
Chromosome
11
Map Location
chromosome:11
Proteins
| Refseq ID | XP_001099511 |
| Protein GI | 109095937 |
| UniProt ID | F6SNF2 |
| mRNA ID | XM_001099511 |
| Length | 356 |
| MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSHLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS | |
Gene Information
Entrez Gene ID
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0034605 | IEA:Ensembl | P | cellular response to heat |
| GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00604 | Glycosphingolipid biosynthesis - ganglio series |
| mcc00604 | Glycosphingolipid biosynthesis - ganglio series |
| ko00603 | Glycosphingolipid biosynthesis - globo series |
| mcc00603 | Glycosphingolipid biosynthesis - globo series |
| ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| mcc00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| M00069 | Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3 |
| mcc_M00069 | Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3 |
| mcc01100 | Metabolic pathways |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Protein Entry
F6SNF2_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014921 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109095937 | RefSeq | XP_001099511 | 356 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 |
Identical Sequences to LMP014921 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109095937 | GenBank | EHH20580.1 | 356 | Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Macaca mulatta] |
| GI:109095937 | RefSeq | XP_003906151.1 | 356 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Papio anubis] |
| GI:109095937 | RefSeq | XP_005570409.1 | 356 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase isoform X1 [Macaca fascicularis] |
Related Sequences to LMP014921 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109095937 | RefSeq | XP_007966077.1 | 356 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase isoform X1 [Chlorocebus sabaeus] |