Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001100908 |
| Protein GI | 109082445 |
| mRNA ID | XM_001100908 |
| Length | 367 |
| MRADSDPWAIAHPAMPLGPDPDECGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014922 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109082445 | RefSeq | XP_001100908 | 367 |
Identical Sequences to LMP014922 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014922 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109082445 | GenBank | JAA03889.1 | 375 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 [Pan troglodytes] |
| GI:109082445 | GenBank | JAA25830.1 | 375 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 [Pan troglodytes] |
| GI:109082445 | GenBank | JAA42477.1 | 375 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 [Pan troglodytes] |
| GI:109082445 | RefSeq | XP_005560609.1 | 375 | PREDICTED: alpha-2,8-sialyltransferase 8B isoform X1 [Macaca fascicularis] |