Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001106765 |
Protein GI | 109074609 |
UniProt ID | F6RUQ2 |
mRNA ID | XM_001106765 |
Length | 294 |
MNSELDYYENFEELHGVLMYKDFVKYWDDVETFQARPDDLVIATYPKSGTTWVSEIAYMIYKEGDVEKCKEDVIFNRIPFLECRKEDLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKNCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKEKSPRILFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDKIIHHTSFQEMKNNPSTNYTTLPDEIMNQKVSPFMRKGITGDWKNHFTVALNEKFDKHYEEQMKESTLKFRTEI |
Gene Information
Entrez Gene ID
Gene Name
sulfotransferase family 1E, estrogen-preferring, member 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:Ensembl | C | cytoplasm |
GO:0047894 | IEA:Ensembl | F | flavonol 3-sulfotransferase activity |
GO:0050294 | IEA:Ensembl | F | steroid sulfotransferase activity |
GO:0008210 | IEA:Ensembl | P | estrogen metabolic process |
GO:0007565 | IEA:Ensembl | P | female pregnancy |
GO:0051923 | IEA:Ensembl | P | sulfation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
sulfotransferase family 1E, estrogen-preferring, member 1
Protein Entry
F6RUQ2_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Belongs to the sulfotransferase 1 family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014949 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109074609 | RefSeq | XP_001106765 | 294 | sulfotransferase family 1E, estrogen-preferring, member 1 |
Identical Sequences to LMP014949 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109074609 | GenBank | EHH53765.1 | 294 | Estrogen sulfotransferase [Macaca fascicularis] |
Related Sequences to LMP014949 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109074609 | GenBank | ABB76812.1 | 294 | sulfotransferase family 1E, estrogen-preferring, member 1 [Macaca fascicularis] |
GI:109074609 | GenBank | EHH25964.1 | 294 | Estrogen sulfotransferase [Macaca mulatta] |
GI:109074609 | RefSeq | NP_001271752.1 | 294 | sulfotransferase family 1E, estrogen-preferring, member 1 [Macaca fascicularis] |