Gene/Proteome Database (LMPD)
Proteins
| toll-like receptor 4 precursor | |
|---|---|
| Refseq ID | NP_001032169 |
| Protein GI | 198282105 |
| UniProt ID | B3Y632 |
| mRNA ID | NM_001037092 |
| Length | 826 |
| MTSALRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELKFYKIPDNIPFSTKNLDLSFNPLRHLGSYSFLRFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQNIYCKDLQVLHQMPLSNLSLDLSLNPINFIQPGAFKEIRLHKLTLRSNFDDLNVMKTCIQGLAGLEVHRLVLGEFRNERNLEEFDKSSLEGLCNLTIEEFRLTYLDYYLDNIIDLFNCLANVSSFSLVSVSIKRVEDFSYNFRWQHLELVNCKFEQFPTLELESLKRLTFTANKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNDVITMSSNFLGLEKLEHLDFQHSNLKQMSQFSVFLSLRNLIYLDISHTHTRVAFNGIFDGLLSLKVLKMAGNSFQENFLPDIFTDLKNLTFLDLSQCQLEQLSPTAFDTLNKLQVLNMSHNNFFSLDTFPYKCLPSLQVLDYSLNHIMTSNNQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEAERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVFSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGQHIFWRRLRKALLDGRSWNPEEQ | |
| sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2420 peptide sequence: MTSALRLAGTLIPAMAFLSCVRP | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0046696 | IEA:InterPro | C | lipopolysaccharide receptor complex |
| GO:0001875 | IEA:InterPro | F | lipopolysaccharide receptor activity |
| GO:0004888 | IEA:InterPro | F | transmembrane signaling receptor activity |
| GO:0002755 | IEA:InterPro | P | MyD88-dependent toll-like receptor signaling pathway |
| GO:0050829 | IEA:InterPro | P | defense response to Gram-negative bacterium |
| GO:0006954 | IEA:UniProtKB-KW | P | inflammatory response |
| GO:0045087 | IEA:UniProtKB-KW | P | innate immune response |
| GO:0042116 | IEA:InterPro | P | macrophage activation |
| GO:0050707 | IEA:InterPro | P | regulation of cytokine secretion |
| GO:0034142 | IEA:InterPro | P | toll-like receptor 4 signaling pathway |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko05146 | Amoebiasis |
| mcc05146 | Amoebiasis |
| ko05142 | Chagas disease (American trypanosomiasis) |
| mcc05142 | Chagas disease (American trypanosomiasis) |
| mcc04066 | HIF-1 signaling pathway |
| mcc05161 | Hepatitis B |
| ko05321 | Inflammatory bowel disease (IBD) |
| mcc05321 | Inflammatory bowel disease (IBD) |
| ko05164 | Influenza A |
| mcc05164 | Influenza A |
| ko05134 | Legionellosis |
| mcc05134 | Legionellosis |
| ko05140 | Leishmaniasis |
| mcc05140 | Leishmaniasis |
| ko05144 | Malaria |
| mcc05144 | Malaria |
| ko05162 | Measles |
| mcc05162 | Measles |
| mcc04064 | NF-kappa B signaling pathway |
| ko04151 | PI3K-Akt signaling pathway |
| mcc04151 | PI3K-Akt signaling pathway |
| ko05133 | Pertussis |
| mcc05133 | Pertussis |
| ko04145 | Phagosome |
| mcc04145 | Phagosome |
| ko05205 | Proteoglycans in cancer |
| mcc05205 | Proteoglycans in cancer |
| ko05323 | Rheumatoid arthritis |
| mcc05323 | Rheumatoid arthritis |
| ko05132 | Salmonella infection |
| mcc05132 | Salmonella infection |
| ko04620 | Toll-like receptor signaling pathway |
| mcc04620 | Toll-like receptor signaling pathway |
| ko05145 | Toxoplasmosis |
| mcc05145 | Toxoplasmosis |
| ko05152 | Tuberculosis |
| mcc05152 | Tuberculosis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000483 | Cysteine-rich flanking region, C-terminal |
| IPR025875 | Leucine rich repeat 4 |
| IPR001611 | Leucine-rich repeat |
| IPR003591 | Leucine-rich repeat, typical subtype |
| IPR017241 | Toll-like receptor |
| IPR027168 | Toll-like receptor 4 |
| IPR000157 | Toll/interleukin-1 receptor homology (TIR) domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the Toll-like receptor family. |
| Similarity | Contains TIR domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014967 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 198282105 | RefSeq | NP_001032169 | 826 | toll-like receptor 4 precursor |
Identical Sequences to LMP014967 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:198282105 | DBBJ | BAG55041.1 | 826 | toll-like receptor 4 [Macaca mulatta] |
| GI:198282105 | GenBank | EHH23828.1 | 826 | hToll [Macaca mulatta] |
Related Sequences to LMP014967 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:198282105 | DBBJ | BAG55040.1 | 826 | toll-like receptor 4 [Macaca fascicularis] |
| GI:198282105 | RefSeq | XP_005580995.1 | 843 | PREDICTED: LOW QUALITY PROTEIN: toll-like receptor 4 [Macaca fascicularis] |