Gene/Proteome Database (LMPD)

LMPD ID
LMP014994
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
UDP glycosyltransferase 8
Gene Symbol
Alternate Names
UDP glycosyltransferase 8; UDP glycosyltransferase 8 (UDP-galactose ceramide galactosyltransferase);
Chromosome
5
Map Location
chromosome:5

Proteins

Refseq ID XP_001097231
Protein GI 109075468
UniProt ID F7BAK1
mRNA ID XM_001097231
Length 541
MKSYTPYFMLLWSAVGIVKAAKIIIVPPIMFESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDMMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASTVPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFVLLLGAALFYFLLSWVTKFIYRKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKVK

Gene Information

Entrez Gene ID
Gene Name
UDP glycosyltransferase 8
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016758 IEA:InterPro F transferase activity, transferring hexosyl groups
GO:0008088 IEA:Ensembl P axon cargo transport
GO:0007010 IEA:Ensembl P cytoskeleton organization
GO:0048812 IEA:Ensembl P neuron projection morphogenesis
GO:0030913 IEA:Ensembl P paranodal junction assembly
GO:0002175 IEA:Ensembl P protein localization to paranode region of axon

KEGG Pathway Links

KEGG Pathway ID Description
M00067 Cerebroside and sulfatide biosynthesis
mcc_M00067 Cerebroside and sulfatide biosynthesis
mcc01100 Metabolic pathways
ko00600 Sphingolipid metabolism
mcc00600 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase

UniProt Annotations

Entry Information

Gene Name
UDP glycosyltransferase 8
Protein Entry
F7BAK1_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the UDP-glycosyltransferase family.

Identical and Related Proteins

Unique RefSeq proteins for LMP014994 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109075468 RefSeq XP_001097231 541 UDP glycosyltransferase 8

Identical Sequences to LMP014994 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014994 proteins

Reference Database Accession Length Protein Name
GI:109075468 GenBank EHH53920.1 541 hypothetical protein EGM_14635 [Macaca fascicularis]
GI:109075468 GenBank AFE79975.1 541 2-hydroxyacylsphingosine 1-beta-galactosyltransferase precursor [Macaca mulatta]
GI:109075468 RefSeq XP_003899163.1 541 PREDICTED: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [Papio anubis]
GI:109075468 RefSeq XP_005555841.1 541 PREDICTED: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase isoform X2 [Macaca fascicularis]