Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001097231 |
Protein GI | 109075468 |
UniProt ID | F7BAK1 |
mRNA ID | XM_001097231 |
Length | 541 |
MKSYTPYFMLLWSAVGIVKAAKIIIVPPIMFESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDMMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASTVPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFVLLLGAALFYFLLSWVTKFIYRKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKVK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016758 | IEA:InterPro | F | transferase activity, transferring hexosyl groups |
GO:0008088 | IEA:Ensembl | P | axon cargo transport |
GO:0007010 | IEA:Ensembl | P | cytoskeleton organization |
GO:0048812 | IEA:Ensembl | P | neuron projection morphogenesis |
GO:0030913 | IEA:Ensembl | P | paranodal junction assembly |
GO:0002175 | IEA:Ensembl | P | protein localization to paranode region of axon |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00067 | Cerebroside and sulfatide biosynthesis |
mcc_M00067 | Cerebroside and sulfatide biosynthesis |
mcc01100 | Metabolic pathways |
ko00600 | Sphingolipid metabolism |
mcc00600 | Sphingolipid metabolism |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002213 | UDP-glucuronosyl/UDP-glucosyltransferase |
UniProt Annotations
Entry Information
Gene Name
UDP glycosyltransferase 8
Protein Entry
F7BAK1_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Belongs to the UDP-glycosyltransferase family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014994 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109075468 | RefSeq | XP_001097231 | 541 | UDP glycosyltransferase 8 |
Identical Sequences to LMP014994 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014994 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109075468 | GenBank | EHH53920.1 | 541 | hypothetical protein EGM_14635 [Macaca fascicularis] |
GI:109075468 | GenBank | AFE79975.1 | 541 | 2-hydroxyacylsphingosine 1-beta-galactosyltransferase precursor [Macaca mulatta] |
GI:109075468 | RefSeq | XP_003899163.1 | 541 | PREDICTED: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [Papio anubis] |
GI:109075468 | RefSeq | XP_005555841.1 | 541 | PREDICTED: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase isoform X2 [Macaca fascicularis] |