Gene/Proteome Database (LMPD)
Proteins
| probable palmitoyltransferase ZDHHC4 | |
|---|---|
| Refseq ID | NP_001248568 |
| Protein GI | 387763533 |
| UniProt ID | F6RN23 |
| mRNA ID | NM_001261639 |
| Length | 344 |
| Protein sequence is identical to GI:109065931 (mRNA isoform) | |
| Refseq ID | XP_001092099 |
| Protein GI | 109065931 |
| UniProt ID | F6RN23 |
| mRNA ID | XM_001092224 |
| Length | 344 |
| MDFLILFLFYLALVVMGLVLICVCSKTHSLKGLARGGAQIFSCVIPECLQRAMHRSLHYLFHTRNHTFIVLHLVLQAMVYTEYTWEVFGYCQELEFSLYYLLLPYLLLVVNLFSFTLTCVTNPGIITKANELLFLHVYEFDEVMFPKNVRCSTCALRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYLLTLTASAATVAIVSTTFLIHLVVMSDLYQETYVDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLCFALYLAATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHGRKKQE | |
| Refseq ID | XP_001092224 |
| Protein GI | 109065933 |
| UniProt ID | F6RN23 |
| mRNA ID | XM_001092224 |
| Length | 344 |
| Protein sequence is identical to GI:109065931 (mRNA isoform) | |
| Refseq ID | XP_001091519 |
| Protein GI | 109065937 |
| UniProt ID | F6RN23 |
| mRNA ID | XM_001092224 |
| Length | 344 |
| Protein sequence is identical to GI:109065931 (mRNA isoform) | |
| Refseq ID | XP_001091276 |
| Protein GI | 109065941 |
| UniProt ID | F6RN23 |
| mRNA ID | XM_001092224 |
| Length | 292 |
| MHRSLHYLFHTRNHTFIVLHLVLQAMVYTEYTWEVFGYCQELEFSLYYLLLPYLLLVVNLFSFTLTCVTNPGIITKANELLFLHVYEFDEVMFPKNVRCSTCALRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYLLTLTASAATVAIVSTTFLIHLVVMSDLYQETYVDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLCFALYLAATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHGRKKQE | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 4
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 4
Protein Entry
F6RN23_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP015032 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109065931 | RefSeq | XP_001092099 | 344 | zinc finger, DHHC-type containing 4 |
| 109065941 | RefSeq | XP_001091276 | 292 | zinc finger, DHHC-type containing 4 |
Identical Sequences to LMP015032 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:387763533 | GenBank | EHH17135.1 | 344 | Putative palmitoyltransferase ZDHHC4 [Macaca mulatta] |
| GI:387763533 | GenBank | AFE67155.1 | 344 | putative palmitoyltransferase ZDHHC4 [Macaca mulatta] |
| GI:387763533 | GenBank | AFI33612.1 | 344 | putative palmitoyltransferase ZDHHC4 [Macaca mulatta] |
Related Sequences to LMP015032 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:387763533 | RefSeq | XP_005549133.1 | 344 | PREDICTED: probable palmitoyltransferase ZDHHC4 isoform X2 [Macaca fascicularis] |